SV2A polyclonal antibody (A01) View larger

SV2A polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SV2A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SV2A polyclonal antibody (A01)

Brand: Abnova
Reference: H00009900-A01
Product name: SV2A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SV2A.
Gene id: 9900
Gene name: SV2A
Gene alias: KIAA0736|SV2
Gene description: synaptic vesicle glycoprotein 2A
Genbank accession: NM_014849
Immunogen: SV2A (NP_055664, 474 a.a. ~ 530 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSL
Protein accession: NP_055664
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009900-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.38 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SV2A polyclonal antibody (A01) now

Add to cart