| Brand: | Abnova |
| Reference: | H00009899-M05 |
| Product name: | SV2B monoclonal antibody (M05), clone 2C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SV2B. |
| Clone: | 2C6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9899 |
| Gene name: | SV2B |
| Gene alias: | HsT19680|KIAA0735 |
| Gene description: | synaptic vesicle glycoprotein 2B |
| Genbank accession: | NM_014848 |
| Immunogen: | SV2B (NP_055663, 417 a.a. ~ 476 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YFQDEEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDE |
| Protein accession: | NP_055663 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |