Brand: | Abnova |
Reference: | H00009899-A01 |
Product name: | SV2B polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SV2B. |
Gene id: | 9899 |
Gene name: | SV2B |
Gene alias: | HsT19680|KIAA0735 |
Gene description: | synaptic vesicle glycoprotein 2B |
Genbank accession: | NM_014848 |
Immunogen: | SV2B (NP_055663, 417 a.a. ~ 476 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YFQDEEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDE |
Protein accession: | NP_055663 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.71 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SV2B polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of SV2B expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |