Brand: | Abnova |
Reference: | H00009892-A01 |
Product name: | SNAP91 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SNAP91. |
Gene id: | 9892 |
Gene name: | SNAP91 |
Gene alias: | AP180|CALM|DKFZp781O0519|KIAA0656 |
Gene description: | synaptosomal-associated protein, 91kDa homolog (mouse) |
Genbank accession: | NM_014841 |
Immunogen: | SNAP91 (NP_055656, 156 a.a. ~ 255 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAE |
Protein accession: | NP_055656 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SNAP91 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of SNAP91 expression in Daoy. (Isoform : 63.128 kDa) |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |