Cart 146 Product Products 49 784,80 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Cleaved-In...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Acetyl-His...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Cks2...259,07 € -
-
-
-
-
1 x PAKα...259,07 € -
1 x Mas1-like...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Integrin...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x GPR15...259,07 € -
-
-
-
-
-
-
-
-
1 x JAK2...259,07 € -
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
49 784,80 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 146 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 49 784,80 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 49 784,80 €
Data sheet of NUAK1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about NUAK1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009891-A01 |
| Product name: | NUAK1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant NUAK1. |
| Gene id: | 9891 |
| Gene name: | NUAK1 |
| Gene alias: | ARK5|KIAA0537 |
| Gene description: | NUAK family, SNF1-like kinase, 1 |
| Genbank accession: | NM_014840 |
| Immunogen: | NUAK1 (NP_055655, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGVVGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKK |
| Protein accession: | NP_055655 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |