Brand: | Abnova |
Reference: | H00009891-A01 |
Product name: | NUAK1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NUAK1. |
Gene id: | 9891 |
Gene name: | NUAK1 |
Gene alias: | ARK5|KIAA0537 |
Gene description: | NUAK family, SNF1-like kinase, 1 |
Genbank accession: | NM_014840 |
Immunogen: | NUAK1 (NP_055655, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGVVGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKK |
Protein accession: | NP_055655 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |