| Brand: | Abnova |
| Reference: | H00009871-M03 |
| Product name: | SEC24D monoclonal antibody (M03), clone 2D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SEC24D. |
| Clone: | 2D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9871 |
| Gene name: | SEC24D |
| Gene alias: | FLJ43974|KIAA0755 |
| Gene description: | SEC24 family, member D (S. cerevisiae) |
| Genbank accession: | NM_014822 |
| Immunogen: | SEC24D (NP_055637, 935 a.a. ~ 1032 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN |
| Protein accession: | NP_055637 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |