Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SEC24D polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SEC24D polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009871-A01 |
| Product name: | SEC24D polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SEC24D. |
| Gene id: | 9871 |
| Gene name: | SEC24D |
| Gene alias: | FLJ43974|KIAA0755 |
| Gene description: | SEC24 family, member D (S. cerevisiae) |
| Genbank accession: | NM_014822 |
| Immunogen: | SEC24D (NP_055637, 935 a.a. ~ 1032 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN |
| Protein accession: | NP_055637 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Akt Phosphorylates Sec24: New Clues into the Regulation of ER-to-Golgi Trafficking.Sharpe LJ, Luu W, Brown AJ. Traffic. 2011 Jan;12(1):19-27. doi: 10.1111/j.1600-0854.2010.01133.x. Epub 2010 Nov 19. |