| Brand: | Abnova |
| Reference: | H00009852-M01 |
| Product name: | EPM2AIP1 monoclonal antibody (M01), clone 3H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPM2AIP1. |
| Clone: | 3H7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9852 |
| Gene name: | EPM2AIP1 |
| Gene alias: | FLJ11207|KIAA0766 |
| Gene description: | EPM2A (laforin) interacting protein 1 |
| Genbank accession: | NM_014805 |
| Immunogen: | EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN |
| Protein accession: | NP_055620 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | EPM2AIP1 monoclonal antibody (M01), clone 3H7 Western Blot analysis of EPM2AIP1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Deficiency of a Glycogen Synthase-associated Protein, Epm2aip1, Causes Decreased Glycogen Synthesis and Hepatic Insulin Resistance.Turnbull J, Tiberia E, Pereira S, Zhao X, Pencea N, Wheeler AL, Yu WQ, Ivovic A, Naranian T, Israelian N, Draginov A, Piliguian M, Frankland PW, Wang P, Ackerley CA, Giacca A, Minassian BA J Biol Chem. 2013 Nov 29;288(48):34627-37. doi: 10.1074/jbc.M113.483198. Epub 2013 Oct 18. |