Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 044,62 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 044,62 €
Data sheet of GINS1 purified MaxPab rabbit polyclonal antibody (D02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about GINS1 purified MaxPab rabbit polyclonal antibody (D02P)
| Brand: | Abnova |
| Reference: | H00009837-D02P |
| Product name: | GINS1 purified MaxPab rabbit polyclonal antibody (D02P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human GINS1 protein. |
| Gene id: | 9837 |
| Gene name: | GINS1 |
| Gene alias: | KIAA0186|PSF1 |
| Gene description: | GINS complex subunit 1 (Psf1 homolog) |
| Genbank accession: | BC012542.1 |
| Immunogen: | GINS1 (AAH12542.1, 1 a.a. ~ 196 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS |
| Protein accession: | AAH12542.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GINS1 expression in transfected 293T cell line (H00009837-T01) by GINS1 MaxPab polyclonal antibody. Lane 1: GINS1 transfected lysate(21.67 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |