GINS1 MaxPab rabbit polyclonal antibody (D01) View larger

GINS1 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GINS1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about GINS1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00009837-D01
Product name: GINS1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human GINS1 protein.
Gene id: 9837
Gene name: GINS1
Gene alias: KIAA0186|PSF1
Gene description: GINS complex subunit 1 (Psf1 homolog)
Genbank accession: BC012542
Immunogen: GINS1 (NP_066545.2, 1 a.a. ~ 196 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
Protein accession: NP_066545.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00009837-D01-31-15-1.jpg
Application image note: Immunoprecipitation of GINS1 transfected lysate using anti-GINS1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GINS1 purified MaxPab mouse polyclonal antibody (B02P) (H00009837-B02P).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy GINS1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart