Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SPATA2 monoclonal antibody (M01), clone 1F1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about SPATA2 monoclonal antibody (M01), clone 1F1
| Brand: | Abnova |
| Reference: | H00009825-M01 |
| Product name: | SPATA2 monoclonal antibody (M01), clone 1F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SPATA2. |
| Clone: | 1F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9825 |
| Gene name: | SPATA2 |
| Gene alias: | FLJ13167|KIAA0757|PD1|tamo |
| Gene description: | spermatogenesis associated 2 |
| Genbank accession: | NM_006038 |
| Immunogen: | SPATA2 (NP_006029, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVY |
| Protein accession: | NP_006029 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SPATA2 monoclonal antibody (M01), clone 1F1 Western Blot analysis of SPATA2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Upregulated hPuf-A promotes breast cancer tumorigenesis.Fan CC, Lee LY, Yu MY, Tzen CY, Chou C, Chang MS Tumour Biol. 2013 Apr 28. |