| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00009815-M04 |
| Product name: | GIT2 monoclonal antibody (M04), clone 1B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GIT2. |
| Clone: | 1B2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9815 |
| Gene name: | GIT2 |
| Gene alias: | CAT-2|DKFZp686G01261|KIAA0148|MGC760 |
| Gene description: | G protein-coupled receptor kinase interacting ArfGAP 2 |
| Genbank accession: | NM_014776 |
| Immunogen: | GIT2 (NP_055591, 401 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHA |
| Protein accession: | NP_055591 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of GIT2 expression in transfected 293T cell line by GIT2 monoclonal antibody (M04), clone 1B2. Lane 1: GIT2 transfected lysate (Predicted MW: 52.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |