MTSS1 monoclonal antibody (M01A), clone 2G9 View larger

MTSS1 monoclonal antibody (M01A), clone 2G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTSS1 monoclonal antibody (M01A), clone 2G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about MTSS1 monoclonal antibody (M01A), clone 2G9

Brand: Abnova
Reference: H00009788-M01A
Product name: MTSS1 monoclonal antibody (M01A), clone 2G9
Product description: Mouse monoclonal antibody raised against a partial recombinant MTSS1.
Clone: 2G9
Isotype: IgG1 Kappa
Gene id: 9788
Gene name: MTSS1
Gene alias: DKFZp781P2223|FLJ44694|KIAA0429|MIM|MIMA|MIMB
Gene description: metastasis suppressor 1
Genbank accession: BC023998
Immunogen: MTSS1 (AAH23998, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQ
Protein accession: AAH23998
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009788-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009788-M01A-2-A7-1.jpg
Application image note: MTSS1 monoclonal antibody (M01A), clone 2G9. Western Blot analysis of MTSS1 expression in human pancreas.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MTSS1 monoclonal antibody (M01A), clone 2G9 now

Add to cart