Brand: | Abnova |
Reference: | H00009788-M01A |
Product name: | MTSS1 monoclonal antibody (M01A), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MTSS1. |
Clone: | 2G9 |
Isotype: | IgG1 Kappa |
Gene id: | 9788 |
Gene name: | MTSS1 |
Gene alias: | DKFZp781P2223|FLJ44694|KIAA0429|MIM|MIMA|MIMB |
Gene description: | metastasis suppressor 1 |
Genbank accession: | BC023998 |
Immunogen: | MTSS1 (AAH23998, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQ |
Protein accession: | AAH23998 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MTSS1 monoclonal antibody (M01A), clone 2G9. Western Blot analysis of MTSS1 expression in human pancreas. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |