Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SART3 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
More info about SART3 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00009733-B01 |
| Product name: | SART3 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SART3 protein. |
| Gene id: | 9733 |
| Gene name: | SART3 |
| Gene alias: | DSAP1|KIAA0156|MGC138188|P100|RP11-13G14|TIP110|p110|p110(nrb) |
| Gene description: | squamous cell carcinoma antigen recognized by T cells 3 |
| Genbank accession: | BC041638.1 |
| Immunogen: | SART3 (AAH41638.1, 1 a.a. ~ 129 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQVGPGVGSGHLPVFQVLGSPCPGPPP |
| Protein accession: | AAH41638.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SART3 expression in transfected 293T cell line (H00009733-T01) by SART3 MaxPab polyclonal antibody. Lane 1: SART3 transfected lysate(14.19 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Stress granule-associated protein G3BP2 regulates breast tumor initiation.Gupta N, Badeaux M, Liu Y, Naxerova K, Sgroi D, Munn LL, Jain RK, Garkavtsev I. Proc Natl Acad Sci USA. 2017 Jan 31;114(5):1033-1038. Epub 2017 Jan 17. |