Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UBE3C polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about UBE3C polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009690-A01 |
| Product name: | UBE3C polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant UBE3C. |
| Gene id: | 9690 |
| Gene name: | UBE3C |
| Gene alias: | KIAA0010|KIAA10 |
| Gene description: | ubiquitin protein ligase E3C |
| Genbank accession: | NM_014671 |
| Immunogen: | UBE3C (NP_055486, 599 a.a. ~ 698 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | IQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEER |
| Protein accession: | NP_055486 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Alterations in mRNA Expression and Protein Products Following Spinal Cord Injury in Humans.Urso ML, Chen YW, Scrimgeour AG, Lee PC, Lee KF, Clarkson PM. J Physiol. 2007 Mar 15;579(Pt 3):877-92. Epub 2007 Jan 11. |