UBE3C polyclonal antibody (A01) View larger

UBE3C polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE3C polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about UBE3C polyclonal antibody (A01)

Brand: Abnova
Reference: H00009690-A01
Product name: UBE3C polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant UBE3C.
Gene id: 9690
Gene name: UBE3C
Gene alias: KIAA0010|KIAA10
Gene description: ubiquitin protein ligase E3C
Genbank accession: NM_014671
Immunogen: UBE3C (NP_055486, 599 a.a. ~ 698 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: IQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEER
Protein accession: NP_055486
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009690-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Alterations in mRNA Expression and Protein Products Following Spinal Cord Injury in Humans.Urso ML, Chen YW, Scrimgeour AG, Lee PC, Lee KF, Clarkson PM.
J Physiol. 2007 Mar 15;579(Pt 3):877-92. Epub 2007 Jan 11.

Reviews

Buy UBE3C polyclonal antibody (A01) now

Add to cart