No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009685-M03 |
Product name: | ENTH monoclonal antibody (M03), clone 1E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ENTH. |
Clone: | 1E6 |
Isotype: | IgG1 Kappa |
Gene id: | 9685 |
Gene name: | CLINT1 |
Gene alias: | CLINT|ENTH|EPN4|EPNR|EPSINR|FLJ46753|KIAA0171 |
Gene description: | clathrin interactor 1 |
Genbank accession: | NM_014666 |
Immunogen: | ENTH (NP_055481.1, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH |
Protein accession: | NP_055481.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | ENTH monoclonal antibody (M03), clone 1E6. Western Blot analysis of ENTH expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |