| Brand: | Abnova |
| Reference: | H00009669-A01 |
| Product name: | EIF5B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EIF5B. |
| Gene id: | 9669 |
| Gene name: | EIF5B |
| Gene alias: | DKFZp434I036|FLJ10524|IF2|KIAA0741 |
| Gene description: | eukaryotic translation initiation factor 5B |
| Genbank accession: | NM_015904 |
| Immunogen: | EIF5B (NP_056988, 1121 a.a. ~ 1218 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE |
| Protein accession: | NP_056988 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cleavage of eukaryotic initiation factor eIF5B by enterovirus 3C proteases.de Breyne S, Bonderoff JM, Chumakov KM, Lloyd RE, Hellen CU. Virology. 2008 Aug 15;378(1):118-22. Epub 2008 Jun 24. |