| Brand: | Abnova |
| Reference: | H00009653-A01 |
| Product name: | HS2ST1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HS2ST1. |
| Gene id: | 9653 |
| Gene name: | HS2ST1 |
| Gene alias: | FLJ11317|KIAA0448|MGC131986|dJ604K5.2 |
| Gene description: | heparan sulfate 2-O-sulfotransferase 1 |
| Genbank accession: | NM_012262 |
| Immunogen: | HS2ST1 (NP_036394, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW |
| Protein accession: | NP_036394 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HS2ST1 polyclonal antibody (A01), Lot # 060501JCS1. Western Blot analysis of HS2ST1 expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |