No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00009638-B02P |
Product name: | FEZ1 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human FEZ1 protein. |
Gene id: | 9638 |
Gene name: | FEZ1 |
Gene alias: | - |
Gene description: | fasciculation and elongation protein zeta 1 (zygin I) |
Genbank accession: | NM_005103.3 |
Immunogen: | FEZ1 (NP_005094.1, 1 a.a. ~ 392 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEKKASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT |
Protein accession: | NP_005094.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FEZ1 expression in transfected 293T cell line (H00009638-T02) by FEZ1 MaxPab polyclonal antibody. Lane 1: FEZ1 transfected lysate(43.12 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.McKnight NC, Jefferies HB, Alemu EA, Saunders RE, Howell M, Johansen T, Tooze SA. EMBO J. 2012 Feb 21. doi: 10.1038/emboj.2012.36. [Epub ahead of print] |