ISG15 MaxPab rabbit polyclonal antibody (D01) View larger

ISG15 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ISG15 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr,IP

More info about ISG15 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00009636-D01
Product name: ISG15 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human ISG15 protein.
Gene id: 9636
Gene name: ISG15
Gene alias: G1P2|IFI15|UCRP
Gene description: ISG15 ubiquitin-like modifier
Genbank accession: NM_005101.1
Immunogen: ISG15 (ENSP00000368699, 1 a.a. ~ 165 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Protein accession: ENSP00000368699
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009636-D01-2-A4-1.jpg
Application image note: ISG15 MaxPab rabbit polyclonal antibody. Western Blot analysis of ISG15 expression in human spleen.
Applications: WB-Ce,WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy ISG15 MaxPab rabbit polyclonal antibody (D01) now

Add to cart