| Brand: | Abnova |
| Reference: | H00009633-M01 |
| Product name: | MTL5 monoclonal antibody (M01), clone 4H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MTL5. |
| Clone: | 4H4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9633 |
| Gene name: | MTL5 |
| Gene alias: | CXCDC2|MTLT|TESMIN |
| Gene description: | metallothionein-like 5, testis-specific (tesmin) |
| Genbank accession: | NM_004923 |
| Immunogen: | MTL5 (NP_004914, 399 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME |
| Protein accession: | NP_004914 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to MTL5 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |