View larger

GNA14 monoclonal antibody (M06A), clone 2H8

Reference:

Condition: New product

Data sheet of GNA14 monoclonal antibody (M06A), clone 2H8

Brand:	Abnova
Reference:	H00009630-M06A
Product name:	GNA14 monoclonal antibody (M06A), clone 2H8
Product description:	Mouse monoclonal antibody raised against a partial recombinant GNA14.
Clone:	2H8
Isotype:	IgG1 Kappa
Gene id:	9630
Gene name:	GNA14
Gene alias:	-
Gene description:	guanine nucleotide binding protein (G protein), alpha 14
Genbank accession:	BC027886
Immunogen:	GNA14 (AAH27886.1, 150 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL
Protein accession:	AAH27886.1
Storage buffer:	In ascites fluid
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.74 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody (M06A), clone 2H8. Lane 1: GNA14 transfected lysate(41.6 KDa). Lane 2: Non-transfected lysate.
Applications:	ELISA,WB-Re,WB-Tr
Shipping condition:	Dry Ice