| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00009630-M06A |
| Product name: | GNA14 monoclonal antibody (M06A), clone 2H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GNA14. |
| Clone: | 2H8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9630 |
| Gene name: | GNA14 |
| Gene alias: | - |
| Gene description: | guanine nucleotide binding protein (G protein), alpha 14 |
| Genbank accession: | BC027886 |
| Immunogen: | GNA14 (AAH27886.1, 150 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL |
| Protein accession: | AAH27886.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody (M06A), clone 2H8. Lane 1: GNA14 transfected lysate(41.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |