No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00009625-M03A |
| Product name: | AATK monoclonal antibody (M03A), clone 5B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AATK. |
| Clone: | 5B8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9625 |
| Gene name: | AATK |
| Gene alias: | AATYK|AATYK1|KIAA0641|LMR1|LMTK1|p35BP |
| Gene description: | apoptosis-associated tyrosine kinase |
| Genbank accession: | BC047378 |
| Immunogen: | AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG |
| Protein accession: | AAH47378 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | AATK monoclonal antibody (M03A), clone 5B8 Western Blot analysis of AATK expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |