| Brand: | Abnova |
| Reference: | H00009619-M01 |
| Product name: | ABCG1 monoclonal antibody (M01), clone 2E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCG1. |
| Clone: | 2E11 |
| Isotype: | IgG1 Lambda |
| Gene id: | 9619 |
| Gene name: | ABCG1 |
| Gene alias: | ABC8|MGC34313|WHITE1 |
| Gene description: | ATP-binding cassette, sub-family G (WHITE), member 1 |
| Genbank accession: | BC029158 |
| Immunogen: | ABCG1 (AAH29158, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI |
| Protein accession: | AAH29158 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ABCG1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |