| Brand: | Abnova |
| Reference: | H00009609-M01A |
| Product name: | RAB36 monoclonal antibody (M01A), clone 6A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB36. |
| Clone: | 6A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9609 |
| Gene name: | RAB36 |
| Gene alias: | - |
| Gene description: | RAB36, member RAS oncogene family |
| Genbank accession: | NM_004914 |
| Immunogen: | RAB36 (NP_004905, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LVGTKKDLLSGAACEQAEADAVHLAREMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLERQSSARLQVGNGDLIQMEGSPPETQESKRPSSLGCC |
| Protein accession: | NP_004905 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RAB36 monoclonal antibody (M01A), clone 6A6 Western Blot analysis of RAB36 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |