| Brand: | Abnova |
| Reference: | H00009604-M01 |
| Product name: | RNF14 monoclonal antibody (M01), clone 4G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF14. |
| Clone: | 4G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9604 |
| Gene name: | RNF14 |
| Gene alias: | ARA54|FLJ26004|HFB30|HRIHFB2038|TRIAD2 |
| Gene description: | ring finger protein 14 |
| Genbank accession: | NM_004290 |
| Immunogen: | RNF14 (NP_004281, 217 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQL |
| Protein accession: | NP_004281 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of RNF14 over-expressed 293 cell line, cotransfected with RNF14 Validated Chimera RNAi ( Cat # H00009604-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF14 monoclonal antibody (M01), clone 4G9 (Cat # H00009604-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |