| Brand: | Abnova |
| Reference: | H00009589-M01 |
| Product name: | WTAP monoclonal antibody (M01), clone 1B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant WTAP. |
| Clone: | 1B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9589 |
| Gene name: | WTAP |
| Gene alias: | DKFZp686F20131|KIAA0105|MGC3925 |
| Gene description: | Wilms tumor 1 associated protein |
| Genbank accession: | NM_152857 |
| Immunogen: | WTAP (NP_690596.1, 70 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR |
| Protein accession: | NP_690596.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to WTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |