| Brand: | Abnova |
| Reference: | H00009578-M02 |
| Product name: | CDC42BPB monoclonal antibody (M02), clone 6G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC42BPB. |
| Clone: | 6G3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9578 |
| Gene name: | CDC42BPB |
| Gene alias: | KIAA1124|MRCKB |
| Gene description: | CDC42 binding protein kinase beta (DMPK-like) |
| Genbank accession: | AF128625 |
| Immunogen: | CDC42BPB (AAD37506, 1580 a.a. ~ 1679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP |
| Protein accession: | AAD37506 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDC42BPB monoclonal antibody (M02), clone 6G3 Western Blot analysis of CDC42BPB expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |