| Brand: | Abnova |
| Reference: | H00009572-M14 |
| Product name: | NR1D1 monoclonal antibody (M14), clone 1E5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant NR1D1. |
| Clone: | 1E5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9572 |
| Gene name: | NR1D1 |
| Gene alias: | EAR1|THRA1|THRAL|ear-1|hRev |
| Gene description: | nuclear receptor subfamily 1, group D, member 1 |
| Genbank accession: | NM_021724 |
| Immunogen: | NR1D1 (NP_068370, 233 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASG |
| Protein accession: | NP_068370 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |