Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GOSR2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
More info about GOSR2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00009570-B01P |
| Product name: | GOSR2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human GOSR2 protein. |
| Gene id: | 9570 |
| Gene name: | GOSR2 |
| Gene alias: | Bos1|GS27 |
| Gene description: | golgi SNAP receptor complex member 2 |
| Genbank accession: | NM_054022.2 |
| Immunogen: | GOSR2 (NP_473363.1, 1 a.a. ~ 213 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGTQGSCQTAHFGGRSAGSS |
| Protein accession: | NP_473363.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GOSR2 expression in transfected 293T cell line (H00009570-T01) by GOSR2 MaxPab polyclonal antibody. Lane 1: GOSR2 transfected lysate(23.43 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Robust imaging and gene delivery to study human lymphoblastoid cell lines.Jolly LA, Sun Y, Carroll R, Homan CC, Gecz J. J Hum Genet. 2018 Jun 20. [Epub ahead of print] |