No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA |
Brand: | Abnova |
Reference: | H00009567-A01 |
Product name: | GTPBP1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GTPBP1. |
Gene id: | 9567 |
Gene name: | GTPBP1 |
Gene alias: | GP-1|GP1|HSPC018|MGC20069 |
Gene description: | GTP binding protein 1 |
Genbank accession: | NM_004286 |
Immunogen: | GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV |
Protein accession: | NP_004277 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | GTPBP1 polyclonal antibody (A01), Lot # 060117JC01 Western Blot analysis of GTPBP1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |