Cart 8 Product Products 2 061,86 € (empty)
No products
To be determined Shipping
2 061,86 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 061,86 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 061,86 €
Data sheet of GTPBP1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about GTPBP1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009567-A01 |
| Product name: | GTPBP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GTPBP1. |
| Gene id: | 9567 |
| Gene name: | GTPBP1 |
| Gene alias: | GP-1|GP1|HSPC018|MGC20069 |
| Gene description: | GTP binding protein 1 |
| Genbank accession: | NM_004286 |
| Immunogen: | GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV |
| Protein accession: | NP_004277 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GTPBP1 polyclonal antibody (A01), Lot # 060117JC01 Western Blot analysis of GTPBP1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |