Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 769,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 769,00 €
Data sheet of H6PD polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about H6PD polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009563-A01 |
| Product name: | H6PD polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant H6PD. |
| Gene id: | 9563 |
| Gene name: | H6PD |
| Gene alias: | DKFZp686A01246|G6PDH|GDH|MGC87643 |
| Gene description: | hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) |
| Genbank accession: | NM_004285 |
| Immunogen: | H6PD (NP_004276, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HIGHGDLGSPAVLVSRNLFRPSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLLASWNFWTPLLESLAHKAPRL |
| Protein accession: | NP_004276 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |