| Brand: | Abnova |
| Reference: | H00009533-M03 |
| Product name: | POLR1C monoclonal antibody (M03), clone 2E11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant POLR1C. |
| Clone: | 2E11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9533 |
| Gene name: | POLR1C |
| Gene alias: | RPA39|RPA40|RPA5|RPAC1 |
| Gene description: | polymerase (RNA) I polypeptide C, 30kDa |
| Genbank accession: | BC008863 |
| Immunogen: | POLR1C (AAH08863, 1 a.a. ~ 346 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD |
| Protein accession: | AAH08863 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (63.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | POLR1C monoclonal antibody (M03), clone 2E11 Western Blot analysis of POLR1C expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |