Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SPTLC2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SPTLC2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009517-A01 |
| Product name: | SPTLC2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SPTLC2. |
| Gene id: | 9517 |
| Gene name: | SPTLC2 |
| Gene alias: | KIAA0526|LCB2|SPT2 |
| Gene description: | serine palmitoyltransferase, long chain base subunit 2 |
| Genbank accession: | NM_004863 |
| Immunogen: | SPTLC2 (NP_004854, 453 a.a. ~ 561 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETE |
| Protein accession: | NP_004854 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | SPTLC2 polyclonal antibody (A01), Lot # 051123JC01. Western Blot analysis of SPTLC2 expression in Raw 264.7. (65kDa,OMIM,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605720) |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | ORMDL orosomucoid-like proteins are degraded by free-cholesterol-loading-induced autophagy.Wang S, Robinet P, Smith JD, Gulshan K Proc Natl Acad Sci U S A. 2015 Mar 24;112(12):3728-33. doi: 10.1073/pnas.1422455112. Epub 2015 Mar 9. |