Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LITAF monoclonal antibody (M01), clone 2E12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about LITAF monoclonal antibody (M01), clone 2E12
| Brand: | Abnova |
| Reference: | H00009516-M01 |
| Product name: | LITAF monoclonal antibody (M01), clone 2E12 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant LITAF. |
| Clone: | 2E12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9516 |
| Gene name: | LITAF |
| Gene alias: | FLJ38636|MGC116698|MGC116700|MGC116701|MGC125274|MGC125275|MGC125276|PIG7|SIMPLE|TP53I7 |
| Gene description: | lipopolysaccharide-induced TNF factor |
| Genbank accession: | NM_004862.2 |
| Immunogen: | LITAF (NP_004853.2, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL |
| Protein accession: | NP_004853.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged LITAF is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |