No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IHC-P,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00009516-B01P |
Product name: | LITAF purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human LITAF protein. |
Gene id: | 9516 |
Gene name: | LITAF |
Gene alias: | FLJ38636|MGC116698|MGC116700|MGC116701|MGC125274|MGC125275|MGC125276|PIG7|SIMPLE|TP53I7 |
Gene description: | lipopolysaccharide-induced TNF factor |
Genbank accession: | NM_004862.2 |
Immunogen: | LITAF (NP_004853.2, 1 a.a. ~ 161 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL |
Protein accession: | NP_004853.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LITAF expression in transfected 293T cell line (H00009516-T01) by LITAF MaxPab polyclonal antibody. Lane 1: LITAF transfected lysate(17.71 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,IHC-P,IF,WB-Tr |
Shipping condition: | Dry Ice |