GAL3ST1 monoclonal antibody (M07), clone 4F6 View larger

GAL3ST1 monoclonal antibody (M07), clone 4F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GAL3ST1 monoclonal antibody (M07), clone 4F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GAL3ST1 monoclonal antibody (M07), clone 4F6

Brand: Abnova
Reference: H00009514-M07
Product name: GAL3ST1 monoclonal antibody (M07), clone 4F6
Product description: Mouse monoclonal antibody raised against a partial recombinant GAL3ST1.
Clone: 4F6
Isotype: IgG1 Kappa
Gene id: 9514
Gene name: GAL3ST1
Gene alias: CST
Gene description: galactose-3-O-sulfotransferase 1
Genbank accession: NM_004861
Immunogen: GAL3ST1 (NP_004852, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RERMAREVAALRHANERMRTICIDGGHAVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWVTKLWKFIRDFLRW
Protein accession: NP_004852
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009514-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009514-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GAL3ST1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GAL3ST1 monoclonal antibody (M07), clone 4F6 now

Add to cart