Brand: | Abnova |
Reference: | H00009510-M01 |
Product name: | ADAMTS1 monoclonal antibody (M01), clone 2A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAMTS1. |
Clone: | 2A9 |
Isotype: | IgG1 Kappa |
Gene id: | 9510 |
Gene name: | ADAMTS1 |
Gene alias: | C3-C5|KIAA1346|METH1 |
Gene description: | ADAM metallopeptidase with thrombospondin type 1 motif, 1 |
Genbank accession: | BC036515 |
Immunogen: | ADAMTS1 (AAH36515, 858 a.a. ~ 967 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS |
Protein accession: | AAH36515 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADAMTS1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |