| Brand: | Abnova |
| Reference: | H00009509-M03 |
| Product name: | ADAMTS2 monoclonal antibody (M03), clone 7G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAMTS2. |
| Clone: | 7G3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9509 |
| Gene name: | ADAMTS2 |
| Gene alias: | ADAM-TS2|ADAMTS-3|NPI|PCINP|PCPNI|hPCPNI |
| Gene description: | ADAM metallopeptidase with thrombospondin type 1 motif, 2 |
| Genbank accession: | NM_014244 |
| Immunogen: | ADAMTS2 (NP_055059, 1112 a.a. ~ 1210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK |
| Protein accession: | NP_055059 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | ADAMTS2 monoclonal antibody (M03), clone 7G3 Western Blot analysis of ADAMTS2 expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |