ADAMTS3 monoclonal antibody (M08A), clone 1D6 View larger

ADAMTS3 monoclonal antibody (M08A), clone 1D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAMTS3 monoclonal antibody (M08A), clone 1D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ADAMTS3 monoclonal antibody (M08A), clone 1D6

Brand: Abnova
Reference: H00009508-M08A
Product name: ADAMTS3 monoclonal antibody (M08A), clone 1D6
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAMTS3.
Clone: 1D6
Isotype: IgG2a Kappa
Gene id: 9508
Gene name: ADAMTS3
Gene alias: ADAMTS-4|KIAA0366
Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 3
Genbank accession: NM_014243
Immunogen: ADAMTS3 (NP_055058.1, 1048 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN
Protein accession: NP_055058.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009508-M08A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009508-M08A-1-6-1.jpg
Application image note: ADAMTS3 monoclonal antibody (M08A), clone 1D6. Western Blot analysis of ADAMTS3 expression in Jurkat.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ADAMTS3 monoclonal antibody (M08A), clone 1D6 now

Add to cart