Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PAGE4 monoclonal antibody (M01), clone 7C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PAGE4 monoclonal antibody (M01), clone 7C3
| Brand: | Abnova |
| Reference: | H00009506-M01 |
| Product name: | PAGE4 monoclonal antibody (M01), clone 7C3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PAGE4. |
| Clone: | 7C3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9506 |
| Gene name: | PAGE4 |
| Gene alias: | FLJ35184|GAGE-9|GAGEC1|JM-27|JM27|PAGE-1|PAGE-4 |
| Gene description: | P antigen family, member 4 (prostate associated) |
| Genbank accession: | NM_007003.2 |
| Immunogen: | PAGE4 (NP_008934.1, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP |
| Protein accession: | NP_008934.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.6 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PAGE4 expression in transfected 293T cell line by PAGE4 monoclonal antibody (M01), clone 7C3. Lane 1: PAGE4 transfected lysate(11.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |