PAGE4 purified MaxPab mouse polyclonal antibody (B01P) View larger

PAGE4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAGE4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PAGE4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009506-B01P
Product name: PAGE4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PAGE4 protein.
Gene id: 9506
Gene name: PAGE4
Gene alias: FLJ35184|GAGE-9|GAGEC1|JM-27|JM27|PAGE-1|PAGE-4
Gene description: P antigen family, member 4 (prostate associated)
Genbank accession: NM_007003.2
Immunogen: PAGE4 (NP_008934.1, 1 a.a. ~ 102 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Protein accession: NP_008934.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009506-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PAGE4 expression in transfected 293T cell line (H00009506-T01) by PAGE4 MaxPab polyclonal antibody.

Lane 1: PAGE4 transfected lysate(11.22 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PAGE4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart