Brand: | Abnova |
Reference: | H00009502-M12 |
Product name: | XAGE2 monoclonal antibody (M12), clone 4C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant XAGE2. |
Clone: | 4C4 |
Isotype: | IgG1 Kappa |
Gene id: | 9502 |
Gene name: | XAGE2 |
Gene alias: | GAGED3|XAGE-2 |
Gene description: | X antigen family, member 2 |
Genbank accession: | NM_130777 |
Immunogen: | XAGE2 (NP_570133, 44 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV |
Protein accession: | NP_570133 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged XAGE2 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |