SLC25A27 purified MaxPab mouse polyclonal antibody (B01P) View larger

SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009481-B01P
Product name: SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SLC25A27 protein.
Gene id: 9481
Gene name: SLC25A27
Gene alias: FLJ33552|UCP4
Gene description: solute carrier family 25, member 27
Genbank accession: BC033091
Immunogen: SLC25A27 (AAH33091, 1 a.a. ~ 245 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLVNPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSDLVGSHKAIQ
Protein accession: AAH33091
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009481-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SLC25A27 expression in transfected 293T cell line (H00009481-T01) by SLC25A27 MaxPab polyclonal antibody.

Lane 1: SLC25A27 transfected lysate(27.06 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SLC25A27 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart