| Brand: | Abnova |
| Reference: | H00009475-M02 |
| Product name: | ROCK2 monoclonal antibody (M02), clone 1E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ROCK2. |
| Clone: | 1E12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9475 |
| Gene name: | ROCK2 |
| Gene alias: | KIAA0619 |
| Gene description: | Rho-associated, coiled-coil containing protein kinase 2 |
| Genbank accession: | NM_004850 |
| Immunogen: | ROCK2 (NP_004841, 1279 a.a. ~ 1388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS |
| Protein accession: | NP_004841 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ROCK2 monoclonal antibody (M02), clone 1E12 Western Blot analysis of ROCK2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Vascular hyperpermeability in response to inflammatory mustard oil is mediated by Rho kinase in mice systemically exposed to arsenic.Chen SC, Liu CC, Huang SY, Chiou SJ. Microvasc Res. 2011 Jun 16. [Epub ahead of print] |