ROCK2 monoclonal antibody (M01), clone 2A4 View larger

ROCK2 monoclonal antibody (M01), clone 2A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ROCK2 monoclonal antibody (M01), clone 2A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about ROCK2 monoclonal antibody (M01), clone 2A4

Brand: Abnova
Reference: H00009475-M01
Product name: ROCK2 monoclonal antibody (M01), clone 2A4
Product description: Mouse monoclonal antibody raised against a partial recombinant ROCK2.
Clone: 2A4
Isotype: IgG2b Kappa
Gene id: 9475
Gene name: ROCK2
Gene alias: KIAA0619
Gene description: Rho-associated, coiled-coil containing protein kinase 2
Genbank accession: NM_004850
Immunogen: ROCK2 (NP_004841, 1279 a.a. ~ 1388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
Protein accession: NP_004841
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009475-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009475-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ROCK2 monoclonal antibody (M01), clone 2A4 now

Add to cart