ATG5 monoclonal antibody (M11), clone 2G8 View larger

ATG5 monoclonal antibody (M11), clone 2G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATG5 monoclonal antibody (M11), clone 2G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ATG5 monoclonal antibody (M11), clone 2G8

Brand: Abnova
Reference: H00009474-M11
Product name: ATG5 monoclonal antibody (M11), clone 2G8
Product description: Mouse monoclonal antibody raised against a partial recombinant ATG5.
Clone: 2G8
Isotype: IgG2a Kappa
Gene id: 9474
Gene name: ATG5
Gene alias: APG5|APG5-LIKE|APG5L|ASP|hAPG5
Gene description: ATG5 autophagy related 5 homolog (S. cerevisiae)
Genbank accession: BC002699
Immunogen: ATG5 (AAH02699, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
Protein accession: AAH02699
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009474-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009474-M11-1-6-1.jpg
Application image note: ATG5 monoclonal antibody (M11), clone 2G8. Western Blot analysis of ATG5 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATG5 monoclonal antibody (M11), clone 2G8 now

Add to cart