| Brand: | Abnova |
| Reference: | H00009474-M11 |
| Product name: | ATG5 monoclonal antibody (M11), clone 2G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATG5. |
| Clone: | 2G8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9474 |
| Gene name: | ATG5 |
| Gene alias: | APG5|APG5-LIKE|APG5L|ASP|hAPG5 |
| Gene description: | ATG5 autophagy related 5 homolog (S. cerevisiae) |
| Genbank accession: | BC002699 |
| Immunogen: | ATG5 (AAH02699, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
| Protein accession: | AAH02699 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ATG5 monoclonal antibody (M11), clone 2G8. Western Blot analysis of ATG5 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |