Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 568,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 568,00 €
Data sheet of ATG5 monoclonal antibody (M08), clone 4B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about ATG5 monoclonal antibody (M08), clone 4B2
| Brand: | Abnova |
| Reference: | H00009474-M08 |
| Product name: | ATG5 monoclonal antibody (M08), clone 4B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATG5. |
| Clone: | 4B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9474 |
| Gene name: | ATG5 |
| Gene alias: | APG5|APG5-LIKE|APG5L|ASP|hAPG5 |
| Gene description: | ATG5 autophagy related 5 homolog (S. cerevisiae) |
| Genbank accession: | BC002699 |
| Immunogen: | ATG5 (AAH02699, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
| Protein accession: | AAH02699 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ATG5 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | WWOX suppresses autophagy for inducing apoptosis in methotrexate-treated human squamous cell carcinoma.Tsai CW, Lai FJ, Sheu HM, Lin YS, Chang TH, Jan MS, Chen SM, Hsu PC, Huang TT, Huang TC, Sheen MC, Chen ST, Chang WC, Chang NS, Hsu LJ Cell Death Dis. 2013 Sep 5;4:e792. doi: 10.1038/cddis.2013.308. |