Cart 2 Product Products 919,20 € (empty)
No products
To be determined Shipping
919,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 919,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 919,20 €
Data sheet of ATG5 monoclonal antibody (M04), clone 1G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ATG5 monoclonal antibody (M04), clone 1G11
| Brand: | Abnova |
| Reference: | H00009474-M04 |
| Product name: | ATG5 monoclonal antibody (M04), clone 1G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATG5. |
| Clone: | 1G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9474 |
| Gene name: | ATG5 |
| Gene alias: | APG5|APG5-LIKE|APG5L|ASP|hAPG5 |
| Gene description: | ATG5 autophagy related 5 homolog (S. cerevisiae) |
| Genbank accession: | BC002699 |
| Immunogen: | ATG5 (AAH02699, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
| Protein accession: | AAH02699 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Autophagy contributes to the survival of CD133+ liver cancer stem cells in the hypoxic and nutrient-deprived tumor microenvironment.Song YJ, Zhang SS, Guo XL, Sun K, Han ZP, Li R, Zhao QD, Deng WJ, Xie XQ, Zhang JW, Wu MC, Wei LX Cancer Lett. 2013 Jul 20. pii: S0304-3835(13)00541-7. doi: 10.1016/j.canlet.2013.07.021. |