Brand: | Abnova |
Reference: | H00009472-M07 |
Product name: | AKAP6 monoclonal antibody (M07), clone 2E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKAP6. |
Clone: | 2E8 |
Isotype: | IgG2b Kappa |
Gene id: | 9472 |
Gene name: | AKAP6 |
Gene alias: | ADAP100|ADAP6|AKAP100|KIAA0311|MGC165020|PRKA6|mAKAP |
Gene description: | A kinase (PRKA) anchor protein 6 |
Genbank accession: | NM_004274 |
Immunogen: | AKAP6 (NP_004265.3, 2221 a.a. ~ 2318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMH |
Protein accession: | NP_004265.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |