Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AKAP6 monoclonal antibody (M07), clone 2E8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about AKAP6 monoclonal antibody (M07), clone 2E8
| Brand: | Abnova |
| Reference: | H00009472-M07 |
| Product name: | AKAP6 monoclonal antibody (M07), clone 2E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKAP6. |
| Clone: | 2E8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9472 |
| Gene name: | AKAP6 |
| Gene alias: | ADAP100|ADAP6|AKAP100|KIAA0311|MGC165020|PRKA6|mAKAP |
| Gene description: | A kinase (PRKA) anchor protein 6 |
| Genbank accession: | NM_004274 |
| Immunogen: | AKAP6 (NP_004265.3, 2221 a.a. ~ 2318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMH |
| Protein accession: | NP_004265.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |